Pasang Iklan Baris Gratis Tanpa Daftar

Kategori: Internet - Web Hosting


10 Juni 2019 06:54 | Dibaca 247 kali

Inilah PELUANG BISNIS yang Anda cari. Modal kecil untung BESAR. Bisa langsung jalan saat ini juga. Produk real, laku di pasar, repeat order tinggi, harga murah, halal dan thayyib. GRATIS Web affiliasi + Toko Online + Market Place + Dropship. Yuk Join sekarang! info selengkapnya klik kunjungi website

Iklan Premium

Hosting Unlimited SSD Cuma 339rb Setahun Plus Gratis Domain .com Order Now

01 Oktober 2019 09:15 | Dibaca 215 kali

Kamu lagi cari hosting unlimited murah plus dapat domain? ini dia yang kamu cari hanya 168rb setahun plus gratis domain .com Satu Hosting Untuk Semuanya Hanya Satu Dan Tidak Perlu Banyak Memilih Karena Ini Akan Memenuhi Kebutuhan kamu Unlimited SSD Hosting Menghasilkan Hosting Super Cepat Menggunakan Konfigurasi Intel Xeon/Dual Xeon…

Dikirim Oleh : HostingUnlimitedSSD Link: Kunjungi Website
Alamat: Indonesia Tags: Web Hosting, hoster, hosting unlimited ssd, domain murah, hosting murah, hosting free ssl
Iklan Premium

Mau bisnis pulsa all operator? Disini aja bonus sponsor 25rb, bonus pasangan 15rb Pendaftaran Gratis

16 Mei 2020 17:42 | Dibaca 165 kali

Kamu mau bisnis pulsa all operator PPOB, pln, token listrik, game online, grab, gojek dll tapi bingung? Jangan bingung daftar aja di portal pulsa kami, banyak bonusnya dan dijamin pasti untung, Pendaftaran gratis Keuntungan Bonus sponsor 25rb Bonus pasangan 15rb Bonus pengembangan 1000 Bonus TRX pulsa 50 Gratis web replika…

Dikirim Oleh : Portal Pulsa Link: Kunjungi Website
Alamat: Indonesia Tags: Bisnis Online, bisnis pulsa, agen pulsa, server pulsa indonesia, peluang usaha
Iklan Premium

Central Park Office Tower

05 Januari 2021 13:02 | Dibaca 15 kali

Lokasi di Kawasan Terpadu Podomoro City : Central Park Mall/Apartment, Pullman Hotel, Royal Garden Residence, Mediterania Garden Residence1, Mediterania Garden Residence2. Sebelah Mall Taman Anggrek, Gramedia, Carrefour, Dekat: SMAK1 Penabur, Ukrida, Untar, Mall Ciputra, Terminal Grogol/Busway, Usakti, Jakarta Barat Luas : 143 m2 Kondisi : sudah renovasi , SHM Lantai…

Dikirim Oleh : Liu Hendra Subrata Kontak: 081284776879 Link: Kunjungi Website
Alamat: DKI Jakarta Tags: Kantor, jual kantor strategis, sewa ruang kantor
Iklan Premium

Massage Panggilan Online Jakarta

15 Januari 2021 23:20 | Dibaca 14 kali

Massage Panggilan Jakarta Traditional Massage & Body Glow khusus Hotel & Apartemen Terapis Kami Berpengalaman Melayani Dengan Hati dan dengan biaya Terjangkau tentunya, Jasa Kami Khusus Hotel & Apartement Saja. Apa itu Traditional Massage? Traditional Massage Adalah Pijat dari telapak kaki dan badan, finishing di urut memakai krim untuk…

Dikirim Oleh : Kontak: 08881588212 Link: Kunjungi Website
Alamat: Jakarta Tags: Jasa, massage panggilan online jakarta, massage jakarta, traditional massage, massage body glow
Iklan Premium


18 Januari 2021 08:58 | Dibaca 2 kali

Kapolri Jenderal (Pol) Idham Azis menjadi anggota kepolisian pertama yang akan menerima suntikan vaksin Covid-19 perdana

Pengiklan: IDLOOS, Alamat: SURABAYA, Kontak: -
Link: Link Website Tags: Web Hosting, kapolrimenjadidaftarpertamapenerimavaksindikorpbhayangkara

Manfaat Menggunakan Litespeed Web Server

14 Januari 2020 06:52 | Dibaca 82 kali

Pada kesempatan kali ini Kami akan membuat artikel tentang pengenalan apa itu litespeed, di karenakan Litespeed adalah sebuah terobosan baru dari teknologi web server yang merupakan pengganti Apache Web Server.Silahkan bisa di pelajari atau simak Mengenal Lebih Dekat Litespeed Apa itu Litespeed Web Server? Litespeed Web Server adalah teknologi Web…

Pengiklan: Tutorial Net, Alamat: Indonesia
Link: Link Website Tags: Web Hosting, domain murah, hosting unlimited, litespeed

Ini Pengertian Domain dan Hosting serta berbagai macam jenisnya

13 Januari 2020 07:55 | Dibaca 78 kali

Saat Anda berselancar di internet, Anda mungkin sering mendengar kata domain dan hosting. Apalagi jika Anda baru membuat website, mungkin Anda akan bingung tentang perbedaan domain dan hosting. Pada artikel kali ini,kami akan membahas beberapa hal tentang domain dan hosting yang dapat Anda pelajari. Definisi Domain Domain diibaratkan sebagai alamat.…

Pengiklan: NetBiz, Alamat: Indonesia
Link: Link Website Tags: Web Hosting, hosting indonesia, domain gratis

HOSTER - Hosting Unlimited SSD Cuma 168rb Setahun Plus Domain Com Order Now

03 Oktober 2019 01:25 | Dibaca 66 kali

Kamu lagi cari hosting unlimited murah plus dapat domain? ini dia yang kamu cari hanya 168rb setahun plus domain .com Satu Hosting Untuk Semuanya Hanya Satu Dan Tidak Perlu Banyak Memilih Karena Ini Akan Memenuhi Kebutuhan kamu Unlimited SSD Hosting Menghasilkan Hosting Super Cepat Menggunakan Konfigurasi Intel Xeon/Dual Xeon Server,…

Pengiklan: HostingUnlimitedSSD, Alamat: Indonesia
Link: Link Website Tags: Web Hosting, hoster, hosting unlimited ssd, domain murah, hosting murah, hosting free ssl